biohacking$bioLLM CA: TBA

database / incretin

GLP-1 (7-37)

also known as glucagon-like peptide-1

research compound incretin metabolicendocrine no independent mass to check against

Sequence

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG

His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly

1. His — Histidine · positive · hydropathy -3.2 · charge 0H12. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A3. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E4. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G5. Thr — Threonine · polar · hydropathy -0.7 · charge 0T6. Phe — Phenylalanine · aromatic · hydropathy 2.8 · charge 0F67. Thr — Threonine · polar · hydropathy -0.7 · charge 0T8. Ser — Serine · polar · hydropathy -0.8 · charge 0S9. Asp — Aspartic acid · negative · hydropathy -3.5 · charge −1D10. Val — Valine · hydrophobic · hydropathy 4.2 · charge 0V11. Ser — Serine · polar · hydropathy -0.8 · charge 0S1112. Ser — Serine · polar · hydropathy -0.8 · charge 0S13. Tyr — Tyrosine · aromatic · hydropathy -1.3 · charge 0Y14. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L15. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E16. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G1617. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q18. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A19. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A20. Lys — Lysine · positive · hydropathy -3.9 · charge +1K21. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E2122. Phe — Phenylalanine · aromatic · hydropathy 2.8 · charge 0F23. Ile — Isoleucine · hydrophobic · hydropathy 4.5 · charge 0I24. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A25. Trp — Tryptophan · aromatic · hydropathy -0.9 · charge 0W26. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L2627. Val — Valine · hydrophobic · hydropathy 4.2 · charge 0V28. Lys — Lysine · positive · hydropathy -3.9 · charge +1K29. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G30. Arg — Arginine · positive · hydropathy -4.5 · charge +1R31. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G31

No independent molecular weight was available to check the sequence against.

Molecular data

Chemical fields come from the PubChem compound record; computed values are derived from the sequence shown above.
molecular formulanot characterised
molecular weight3355.71 Da (computed from sequence)
computed backbone mass3355.71 Da
length31 residues
net charge (pH 7.4)-1
mean hydropathy-0.24
half-lifenot characterised
delivery routenot characterised
PubChem CIDnot characterised
PDBnot characterised
UniProt parentP01275

Mechanism

Endogenous incretin; potentiates glucose-dependent insulin secretion.

Reported targets: GLP-1R

Experimental structure

No experimental structure deposited in the PDB. A predicted fold is not a structure, so nothing is drawn.

Helical wheel

1. His — Histidine · positiveH2. Ala — Alanine · hydrophobicA3. Glu — Glutamic acid · negativeE4. Gly — Glycine · glycineG5. Thr — Threonine · polarT6. Phe — Phenylalanine · aromaticF7. Thr — Threonine · polarT8. Ser — Serine · polarS9. Asp — Aspartic acid · negativeD10. Val — Valine · hydrophobicV11. Ser — Serine · polarS12. Ser — Serine · polarS13. Tyr — Tyrosine · aromaticY14. Leu — Leucine · hydrophobicL15. Glu — Glutamic acid · negativeE16. Gly — Glycine · glycineG17. Gln — Glutamine · polarQ18. Ala — Alanine · hydrophobicA

Residues projected at 100° per turn, the standard α-helix rotation. Shown because helicity in this peptide is described in the cited literature.

Position in the parent protein

exact match at residues 98–128 of Pro-glucagon (180 aa)

…FVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFS…

Parent sequence from UniProt P01275. GLP-1 is a proglucagon cleavage product.

Reported effects

Each row is an outcome described in the literature indexed for this peptide.

Reported observations and the corpus they are drawn from.
reported outcomewhere it appears
insulin secretionDrugs are not cutting it: Patient motivations for metabolic and bariatric su… Surgery 2026
gastric emptying delayGlucagon-Like Peptide-1 Receptor Agonists for Obstructive Sleep Apnea With a… Otolaryngology--head and neck surgery : official journal of American Academy of Otolaryngology-Head and Neck Surgery 2026
satietyEffects of Glucagon-Like Peptide-1 Receptor Agonists as Weight Loss Drugs on… Hormone and metabolic research = Hormon- und Stoffwechselforschung = Hormones et metabolisme 2026

Literature (8)

Drugs are not cutting it: Patient motivations for metabolic and bariatric surgery despite glucagon-like peptide-1 use — Surgery 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42623901 · DOI 10.1016/j.surg.2026.110492

Glucagon-Like Peptide-1 Receptor Agonists for Obstructive Sleep Apnea With and Without Continuous Positive Airway Pressure — Otolaryngology--head and neck surgery : official journal of American Academy of Otolaryngology-Head and Neck Surgery 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42611692 · DOI 10.1002/ohn.70407

Effects of Glucagon-Like Peptide-1 Receptor Agonists as Weight Loss Drugs on Pancreatitis and Pancreatic Cancer: A Meta-Analysis — Hormone and metabolic research = Hormon- und Stoffwechselforschung = Hormones et metabolisme 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42600634 · DOI 10.1055/a-2923-3830

Unravelling obesity: from leptin to glucagon-like peptide-1 receptor agonists — Journal of applied genetics 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42298277 · DOI 10.1007/s13353-026-01084-5

Glucagon-like peptide-1 receptor agonists and bowel preparation: methodological and clinical considerations for meta-analysis — Gastrointestinal endoscopy 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42601135 · DOI 10.1016/j.gie.2026.03.005

Glucagon-Like Peptide-1 Receptor Agonists Therapy: The Biological Bridge Across Comorbidities in Behavioral Health — Rhode Island medical journal (2013) 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42647832

Risk of Diabetic Ketoacidosis with Glucagon-Like Peptide-1 Receptor Agonists: A Systematic Review and Meta-analysis — Research Square 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · DOI 10.21203/rs.3.rs-10216709/v1

Adjunctive GLP1 Receptor Agonists in Patients With Inflammatory Bowel Diseases and Obesity and/or Diabetes: A Target Trial Emulation — Clinical gastroenterology and hepatology : the official clinical practice journal of the American Gastroenterological Association 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42309434 · DOI 10.1016/j.cgh.2026.06.008

The mechanism, illustrated

Not memed yet.

33 of the 100 indexed peptides have one. See which →

Related

Semaglutide

incretin · 8 citations

Tirzepatide

incretin · 8 citations

Retatrutide

incretin · 8 citations

Liraglutide

incretin · 8 citations

Exenatide

incretin · 8 citations

GIP

incretin · 8 citations