database / metabolic
GLP-2
also known as glucagon-like peptide-2
Sequence
HADGSFSDEMNTILDNLAARDFINWLIQTKITD
His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp
- hydrophobic
- positive
- negative
- polar
- aromatic
- glycine
- proline
- cysteine
No independent molecular weight was available to check the sequence against.
Molecular data
| molecular formula | not characterised |
|---|---|
| molecular weight | 3766.15 Da (computed from sequence) |
| computed backbone mass | 3766.15 Da |
| length | 33 residues |
| net charge (pH 7.4) | -4 |
| mean hydropathy | -0.28 |
| half-life | not characterised |
| delivery route | not characterised |
| PubChem CID | not characterised |
| PDB | not characterised |
| UniProt parent | P01275 |
Mechanism
GLP-2 receptor agonist; trophic to intestinal mucosa.
Reported targets: GLP-2R
Experimental structure
No experimental structure deposited in the PDB. A predicted fold is not a structure, so nothing is drawn.
Position in the parent protein
…WLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
Parent sequence from UniProt P01275. GLP-2 is a proglucagon cleavage product.
Reported effects
Each row is an outcome described in the literature indexed for this peptide.
| reported outcome | where it appears |
|---|---|
| intestinal mucosal growth | The Role of Vasoactive Intestinal Peptide in Glucagon-like Peptide-2-Mediate… International journal of molecular sciences 2026 |
| nutrient absorption | Segmental fructose handling may refine the temporal glucagon-like peptide-1-… The Journal of physiology 2026 |
Literature (8)
The Role of Vasoactive Intestinal Peptide in Glucagon-like Peptide-2-Mediated Intestinal Lipid Handling — International journal of molecular sciences 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
Segmental fructose handling may refine the temporal glucagon-like peptide-1-glucagon-like peptide-2 framework during chronic fructose exposure — The Journal of physiology 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42246924 · DOI 10.1113/jp291479
Reply to Huang et al.: 'Segmental fructose handling may refine the temporal glucagon-like peptide-1/glucagon-like peptide-2 framework during chronic fructose exposure' — The Journal of physiology 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42285753 · DOI 10.1113/jp291700
EVIDENCE OF THE INFLUENCE OF GLUCAGON-LIKE PEPTIDE ANALOGS IN INFLAMMATORY BOWEL DISEASE: A SCOPING REVIEW — Arquivos de gastroenterologia 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42615757 · DOI 10.1590/s0004-2803.24612026-028
Dysfunctional Lipid-Induced Secretion of Glucagon-Like Peptide-2(GLP-2), but Not of Incretins Glucagon-Like Peptide-1(GLP-1)/Glucose-Dependent Insulinotropic Polypeptide(GIP), Promotes Metabolic Dysfunction-Associated Steatotic Liver Disease (MASLD) Onset and Progression Through Gut Barrier Disruption and Endotoxemia — MedComm 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
open access ↗ · PMID 41948456 · DOI 10.1002/mco2.70323
Evaluation of Intestinal Barrier Biomarkers and Glucagon-like Peptide-2 in SIRS-Positive and SIRS-Negative Diarrheic Calves — Animals : an open access journal from MDPI 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42652012 · DOI 10.3390/ani16162607
The Role of Vasoactive Intestinal Peptide in Glucagon-like Peptide-2-Mediated Intestinal Lipid Handling — International journal of molecular sciences 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42353173 · DOI 10.3390/ijms27125457
Glucagon-Like Peptide-2 Ameliorates Lipid Metabolism in Metabolic Dysfunction-Associated Steatotic Liver Disease Through the Adiponectin-Adiponectin Receptor-Mediated AMPK/PPARalpha Pathway — Physiological research 2026
The aim of this study was to investigate the mechanisms by which glucagon-like peptide-2 (GLP-2) improves metabolic dysfunction-associated steatotic liver disease (MASLD) induced by free fatty acids (FFAs) in HepG2 cells, with a focus on the regulation of the adiponectin (ADPN) signaling axis and the downstream AMP-activated protein kinase (AMPK)/peroxisome proliferator-activated receptor alpha (PPARalpha) pathway. An MASLD model was established in HepG2 cells by FFA exposure. Following GLP-2 treatment, improvements in lipid metabolism were evaluated using the Cell Counting Kit-8, Oil Red O staining, and biochemical assays. Differential gene expression was examined using RNA sequencing, and potential mechanisms were evaluated through Gene Ontology enrichment and Kyoto Encyclopedia of Genes and Genomes pathway analysis. Western blotting and reverse transcription polymerase chain reaction …
open access ↗ · PMID 41811706
The mechanism, illustrated
Not memed yet.
33 of the 100 indexed peptides have one. See which →
Related
Teduglutide
metabolic · 8 citations
Pramlintide
metabolic · 8 citations
Leptin fragment (116-130)
metabolic · 6 citations
AOD-9604
metabolic · 8 citations
HGH Fragment 176-191
metabolic · 2 citations
Linaclotide
metabolic · 8 citations