biohacking$bioLLM CA: TBA

database / hormone

Oxytocin

approved hormone reproductivenervous modified — mass check n/a
SSOOOOOOOOOOOONNNNNNNNNNNNHHHHHHHHHHHHHHHH
69 heavy atoms · 137 bonds · drag to pan, scroll to zoom C43O12N12S2

Skeletal structure drawn from the computed atomic coordinates in PubChem CID 439302. Carbons are implicit vertices, hydrogens on carbon suppressed. Every atom sits where PubChem placed it.

Sequence

CYIQNCPLG

Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Leu-Gly

1. Cys — Cysteine · cysteine · hydropathy 2.5 · charge 0C12. Tyr — Tyrosine · aromatic · hydropathy -1.3 · charge 0Y3. Ile — Isoleucine · hydrophobic · hydropathy 4.5 · charge 0I4. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q5. Asn — Asparagine · polar · hydropathy -3.5 · charge 0N6. Cys — Cysteine · cysteine · hydropathy 2.5 · charge 0C67. Pro — Proline · proline · hydropathy -1.6 · charge 0P8. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L9. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G9

Modified molecule. Cyclic via a Cys1–Cys6 disulfide, with a C-terminal amide.

Backbone carries modifications, so computed backbone mass is not comparable to the reported mass of the complete molecule.

Molecular data

Chemical fields come from the PubChem compound record; computed values are derived from the sequence shown above.
molecular formulaC43H66N12O12S2
molecular weight1007.2 Da (PubChem)
computed backbone mass1010.19 Da
length9 residues
net charge (pH 7.4)0
mean hydropathy0.33
half-lifenot characterised
delivery routeintravenous, intranasal
PubChem CID439302
PDB1XY1
UniProt parentP01178

Mechanism

Oxytocin receptor agonist; neurohypophysial nonapeptide.

Reported targets: OXTR

Experimental structure

α-carbon backbone trace rendered from the deposited coordinates of PDB 1XY1. This is measured structure, not a prediction.

Position in the parent protein

exact match at residues 20–28 of Oxytocin-neurophysin 1 proprotein (125 aa)

MAGPSLACCLLGLLALTSACYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRC…

Parent sequence from UniProt P01178. Cleaved from the oxytocin-neurophysin precursor.

Reported effects

Each row is an outcome described in the literature indexed for this peptide.

Reported observations and the corpus they are drawn from.
reported outcomewhere it appears
uterine contractionGene-environment interaction between perinatal oxytocin exposure and Pten mu… Neurobiology of disease 2026
social-behaviour effects in trialsOxytocin National Institute of Child Health and Human Development, Bethesda (MD) 2006
lactationRelation between serum oxytocin levels and impulsivity in patients under tre… International journal of psychiatry in clinical practice 2026

Registered trials

Records from ClinicalTrials.gov. Listed for reference — this project sponsors no trial and is not involved in any of them.
NCTtitlestatusphase
NCT05916989Stimulant Use and Methylation in HIVCOMPLETED
NCT02888574Evaluating the Efficacy of Intranasal Oxytocin Among Individuals With Persistent PainCOMPLETEDPHASE2, PHASE3
NCT07299708Effects of Sleep Quality, Anxiety, and Digital Behavior on Labor Progression in Term PrimipaCOMPLETED
NCT03119610The Physiologic Effects of Intranasal Oxytocin on Sarcopenic ObesityCOMPLETEDPHASE1, PHASE2
NCT00451308Induction of Labor With a Foley Balloon Catheter: Inflation With 30ml Compared to 60mlCOMPLETEDPHASE4

Literature (8)

Gene-environment interaction between perinatal oxytocin exposure and Pten mutation shapes epigenetic reprogramming of oxytocin signaling and behavior in mice — Neurobiology of disease 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42551658 · DOI 10.1016/j.nbd.2026.107559

Oxytocin — National Institute of Child Health and Human Development, Bethesda (MD) 2006

Oxytocin is an essential lactation hormone released during breastfeeding that causes milk ejection and appears to have calming effect on the mother.[1] Administration of exogenous oxytocin to mothers having difficulty in breastfeeding has not been clearly shown to have a beneficial effect on lactation success or in the treatment of breast engorgement. It might be of benefit with spinal cord injury where the neuronal connection between the breast and hypothalamus have been lost or with rare endocrine disorders such as panhypopituitarism. Effects on the infant are unlikely when oxytocin is given during breastfeeding. Some studies suggest that oxytocin given during labor can negatively affect breastfeeding, possibly by reducing sucking behavior in the newborn in a dose-dependent manner, or by decreasing postpartum oxytocin release although study timing of oxytocin administration and study m…

open access ↗ · PMID 30000550

Relation between serum oxytocin levels and impulsivity in patients under treatment for alcohol use disorder — International journal of psychiatry in clinical practice 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42641067 · DOI 10.1080/13651501.2026.2722063

Endogenous oxytocin-linked heart-rate synchrony and social connection during live sports spectatorship — Translational psychiatry 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42420254 · DOI 10.1038/s41398-026-04265-2

Oxytocin promotes advantageous inequity preference by modulating the fairness norm enforcement system — bioRxiv 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · DOI 10.64898/2026.08.11.744311

Oxytocin promotes socially triggered cataplexy — Nature neuroscience 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42449131 · DOI 10.1038/s41593-026-02352-7

Oxytocin Use During Labour: An Analysis of Canadian Medico-legal Obstetrical Case Files — Journal of obstetrics and gynaecology Canada : JOGC = Journal d'obstetrique et gynecologie du Canada : JOGC 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42600775 · DOI 10.1016/j.jogc.2026.103499

Association between salivary oxytocin concentration and social loneliness in older adults: Findings from an uncontrolled pre-post multimodal intervention study — Psychoneuroendocrinology 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42475809 · DOI 10.1016/j.psyneuen.2026.107968

The mechanism, illustrated

Oxytocin drawn as a wojak meme: nine residues and one disulfide bridge
nine residues and one disulfide bridgeAI-generated, drawn from the mechanism above. all 33 →

Related

Glucagon

hormone · 8 citations

Ghrelin

hormone · 8 citations

Vasopressin

hormone · 8 citations

Gonadorelin

hormone · 8 citations

Kisspeptin-10

hormone · 8 citations

Insulin

hormone · 8 citations