database / hormone
Bradykinin
Skeletal structure drawn from the computed atomic coordinates in PubChem CID 439201. Carbons are implicit vertices, hydrogens on carbon suppressed. Every atom sits where PubChem placed it.
Sequence
RPPGFSPFR
Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg
- hydrophobic
- positive
- negative
- polar
- aromatic
- glycine
- proline
- cysteine
Computed backbone mass 1060.22 Da agrees with PubChem's reported 1060.2 Da (Δ 0.02 Da). Two independent sources agree on the primary structure.
Molecular data
| molecular formula | C50H73N15O11 |
|---|---|
| molecular weight | 1060.2 Da (PubChem) |
| computed backbone mass | 1060.22 Da |
| length | 9 residues |
| net charge (pH 7.4) | +2 |
| mean hydropathy | -1.04 |
| half-life | not characterised |
| delivery route | not characterised |
| PubChem CID | 439201 |
| PDB | not characterised |
| UniProt parent | P01042 |
Mechanism
B2 receptor agonist; mediator of vasodilation and pain signalling.
Reported targets: BDKRB2
Experimental structure
No experimental structure deposited in the PDB. A predicted fold is not a structure, so nothing is drawn.
Position in the parent protein
…VVPWEKKIYPTVNCQPLGMISLMKRPPGFSPFRSSRIGEIKEETTVSPPHTSMAPAQ…
Parent sequence from UniProt P01042. Released from kininogen by kallikrein.
Reported effects
Each row is an outcome described in the literature indexed for this peptide.
| reported outcome | where it appears |
|---|---|
| vasodilation | Therapeutic Targeting of the Bradykinin B2 Receptor in Immunological and Vas… Clinical reviews in allergy & immunology 2026 |
| pain signalling | G protein signaling capabilities at the bradykinin 2 receptor Naunyn-Schmiedeberg's archives of pharmacology 2026 |
| vascular permeability | [Current and future therapies for bradykinin-mediated angioedema] Dermatologie (Heidelberg, Germany) 2026 |
Literature (8)
Therapeutic Targeting of the Bradykinin B2 Receptor in Immunological and Vascular Diseases: Insights from Kinin Biology to Clinical Outcomes — Clinical reviews in allergy & immunology 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42397484 · DOI 10.1007/s12016-026-09178-y
G protein signaling capabilities at the bradykinin 2 receptor — Naunyn-Schmiedeberg's archives of pharmacology 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42547588 · DOI 10.1007/s00210-026-05758-z
[Current and future therapies for bradykinin-mediated angioedema] — Dermatologie (Heidelberg, Germany) 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42550203 · DOI 10.1007/s00105-026-05754-7
Pediatric Non-Hereditary, Non-Allergic, Bradykinin-Mediated Angioedema in a Postoperative Intensive Care Patient: A Case Report — Military medicine 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 40966718 · DOI 10.1093/milmed/usaf380
Could bradykinin pathway inhibition change the course of severe hantavirus disease? — Immunology letters 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42251906 · DOI 10.1016/j.imlet.2026.107201
Bradykinin modulates endothelin-1-enhanced and monocrotaline-induced pulmonary arterial hypertension-associated arrhythmogenesis in rabbit right ventricular outflow tract via a nitric oxide-dependent pathway — European journal of pharmacology 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42035941 · DOI 10.1016/j.ejphar.2026.178896
Expression of PGE2, Histamine, Bradykinin, NaV-1.7, NaV-1.8, NaV-1.9 in Nerve Cells of Normal and Inflamed Dental Pulp Tissue Following Pulp Extirpation — European journal of dentistry 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42457135 · DOI 10.1055/s-0046-1824620
[Clinical presentation and diagnosis of bradykinin-mediated angioedema] — Dermatologie (Heidelberg, Germany) 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42640320 · DOI 10.1007/s00105-026-05760-9
The mechanism, illustrated
Not memed yet.
33 of the 100 indexed peptides have one. See which →
Related
Glucagon
hormone · 8 citations
Ghrelin
hormone · 8 citations
Oxytocin
hormone · 8 citations
Vasopressin
hormone · 8 citations
Gonadorelin
hormone · 8 citations
Kisspeptin-10
hormone · 8 citations