biohacking$bioLLM CA: TBA

database / hormone

Bradykinin

research compound hormone cardiovascularnervousimmune mass-verified
OOOOOOOOOOONNNNNNNNNNNNNNNHHHHHHHHHHHHHHHHH
76 heavy atoms · 153 bonds · drag to pan, scroll to zoom C50N15O11

Skeletal structure drawn from the computed atomic coordinates in PubChem CID 439201. Carbons are implicit vertices, hydrogens on carbon suppressed. Every atom sits where PubChem placed it.

Sequence

RPPGFSPFR

Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg

1. Arg — Arginine · positive · hydropathy -4.5 · charge +1R12. Pro — Proline · proline · hydropathy -1.6 · charge 0P3. Pro — Proline · proline · hydropathy -1.6 · charge 0P4. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G5. Phe — Phenylalanine · aromatic · hydropathy 2.8 · charge 0F6. Ser — Serine · polar · hydropathy -0.8 · charge 0S67. Pro — Proline · proline · hydropathy -1.6 · charge 0P8. Phe — Phenylalanine · aromatic · hydropathy 2.8 · charge 0F9. Arg — Arginine · positive · hydropathy -4.5 · charge +1R9

Computed backbone mass 1060.22 Da agrees with PubChem's reported 1060.2 Da (Δ 0.02 Da). Two independent sources agree on the primary structure.

Molecular data

Chemical fields come from the PubChem compound record; computed values are derived from the sequence shown above.
molecular formulaC50H73N15O11
molecular weight1060.2 Da (PubChem)
computed backbone mass1060.22 Da
length9 residues
net charge (pH 7.4)+2
mean hydropathy-1.04
half-lifenot characterised
delivery routenot characterised
PubChem CID439201
PDBnot characterised
UniProt parentP01042

Mechanism

B2 receptor agonist; mediator of vasodilation and pain signalling.

Reported targets: BDKRB2

Experimental structure

No experimental structure deposited in the PDB. A predicted fold is not a structure, so nothing is drawn.

Position in the parent protein

exact match at residues 381–389 of Kininogen-1 (644 aa)

…VVPWEKKIYPTVNCQPLGMISLMKRPPGFSPFRSSRIGEIKEETTVSPPHTSMAPAQ…

Parent sequence from UniProt P01042. Released from kininogen by kallikrein.

Reported effects

Each row is an outcome described in the literature indexed for this peptide.

Reported observations and the corpus they are drawn from.
reported outcomewhere it appears
vasodilationTherapeutic Targeting of the Bradykinin B2 Receptor in Immunological and Vas… Clinical reviews in allergy & immunology 2026
pain signallingG protein signaling capabilities at the bradykinin 2 receptor Naunyn-Schmiedeberg's archives of pharmacology 2026
vascular permeability[Current and future therapies for bradykinin-mediated angioedema] Dermatologie (Heidelberg, Germany) 2026

Literature (8)

Therapeutic Targeting of the Bradykinin B2 Receptor in Immunological and Vascular Diseases: Insights from Kinin Biology to Clinical Outcomes — Clinical reviews in allergy & immunology 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42397484 · DOI 10.1007/s12016-026-09178-y

G protein signaling capabilities at the bradykinin 2 receptor — Naunyn-Schmiedeberg's archives of pharmacology 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42547588 · DOI 10.1007/s00210-026-05758-z

[Current and future therapies for bradykinin-mediated angioedema] — Dermatologie (Heidelberg, Germany) 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42550203 · DOI 10.1007/s00105-026-05754-7

Pediatric Non-Hereditary, Non-Allergic, Bradykinin-Mediated Angioedema in a Postoperative Intensive Care Patient: A Case Report — Military medicine 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 40966718 · DOI 10.1093/milmed/usaf380

Could bradykinin pathway inhibition change the course of severe hantavirus disease? — Immunology letters 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42251906 · DOI 10.1016/j.imlet.2026.107201

Bradykinin modulates endothelin-1-enhanced and monocrotaline-induced pulmonary arterial hypertension-associated arrhythmogenesis in rabbit right ventricular outflow tract via a nitric oxide-dependent pathway — European journal of pharmacology 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42035941 · DOI 10.1016/j.ejphar.2026.178896

Expression of PGE2, Histamine, Bradykinin, NaV-1.7, NaV-1.8, NaV-1.9 in Nerve Cells of Normal and Inflamed Dental Pulp Tissue Following Pulp Extirpation — European journal of dentistry 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42457135 · DOI 10.1055/s-0046-1824620

[Clinical presentation and diagnosis of bradykinin-mediated angioedema] — Dermatologie (Heidelberg, Germany) 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42640320 · DOI 10.1007/s00105-026-05760-9

The mechanism, illustrated

Not memed yet.

33 of the 100 indexed peptides have one. See which →

Related

Glucagon

hormone · 8 citations

Ghrelin

hormone · 8 citations

Oxytocin

hormone · 8 citations

Vasopressin

hormone · 8 citations

Gonadorelin

hormone · 8 citations

Kisspeptin-10

hormone · 8 citations