database / hormone
Leu-enkephalin
Skeletal structure drawn from the computed atomic coordinates in PubChem CID 461776. Carbons are implicit vertices, hydrogens on carbon suppressed. Every atom sits where PubChem placed it.
Sequence
YGGFL
Tyr-Gly-Gly-Phe-Leu
- hydrophobic
- positive
- negative
- polar
- aromatic
- glycine
- proline
- cysteine
Computed backbone mass 555.63 Da agrees with PubChem's reported 555.6 Da (Δ 0.03 Da). Two independent sources agree on the primary structure.
Molecular data
| molecular formula | C28H37N5O7 |
|---|---|
| molecular weight | 555.6 Da (PubChem) |
| computed backbone mass | 555.63 Da |
| length | 5 residues |
| net charge (pH 7.4) | 0 |
| mean hydropathy | 0.9 |
| half-life | not characterised |
| delivery route | not characterised |
| PubChem CID | 461776 |
| PDB | not characterised |
| UniProt parent | P01210 |
Mechanism
Endogenous opioid pentapeptide differing from Met-enkephalin at the C-terminal residue.
Reported targets: DOR
Experimental structure
No experimental structure deposited in the PDB. A predicted fold is not a structure, so nothing is drawn.
Position in the parent protein
…LQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFAEALPSDEEGESYSKEVPEME…
Parent sequence from UniProt P01210. Released from proenkephalin.
Reported effects
Each row is an outcome described in the literature indexed for this peptide.
| reported outcome | where it appears |
|---|---|
| analgesic signalling | Heat and cold stresses exert disparate effects on expression of proenkephali… Poultry science 2026 |
Literature (7)
Heat and cold stresses exert disparate effects on expression of proenkephalin, and concentrations of Met-enkephalin in the hypothalamus, pituitary and adrenal glands, plasma concentrations Met-enkephalin, Leu-enkephalin, β-endorphin and corticosterone and opioid receptor binding in chickens — Poultry science 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42617248 · DOI 10.1016/j.psj.2026.107516
pH-induced transition of sponge-phase nanoparticles to micelles: The case of Leu-enkephalin-squalene lipopeptide prodrug — Journal of colloid and interface science 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42508171 · DOI 10.1016/j.jcis.2026.141196
Amidine isosteric modification tunes proteolytic stability and activity — RSC chemical biology 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42454068 · DOI 10.1039/d6cb00138f
Effects of Neonatal Administration of Non-Opiate Analogues of Leu-Enkephalin on the Delayed Cardiac Consequences of Intrauterine Hypoxia — Bulletin of experimental biology and medicine 2024
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 39342010 · DOI 10.1007/s10517-024-06234-5
Stapling of leu-enkephalin analogs with bifunctional reagents for prolonged analgesic activity — Chemical communications (Cambridge, England) 2024
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 38356394 · DOI 10.1039/d3cc06345c
Inflammatory pain resolution by mouse serum-derived small extracellular vesicles — Brain, behavior, and immunity 2025
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 39349284 · DOI 10.1016/j.bbi.2024.09.032
Cytoprotective Effect of NOP Receptor Blockade in Primary Culture of Pulmonary Fibroblasts — Bulletin of experimental biology and medicine 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42053709 · DOI 10.1007/s10517-026-06670-5
The mechanism, illustrated
Not memed yet.
33 of the 100 indexed peptides have one. See which →
Related
Glucagon
hormone · 8 citations
Ghrelin
hormone · 8 citations
Oxytocin
hormone · 8 citations
Vasopressin
hormone · 8 citations
Gonadorelin
hormone · 8 citations
Kisspeptin-10
hormone · 8 citations