database / hormone
Neuropeptide Y
also known as NPY
Skeletal structure drawn from the computed atomic coordinates in PubChem CID 16132350. Carbons are implicit vertices, hydrogens on carbon suppressed. Every atom sits where PubChem placed it.
Sequence
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr
- hydrophobic
- positive
- negative
- polar
- aromatic
- glycine
- proline
- cysteine
Modified molecule. C-terminal amide; the amide is required for receptor binding.
Backbone carries modifications, so computed backbone mass is not comparable to the reported mass of the complete molecule.
Molecular data
| molecular formula | C190H287N55O57 |
|---|---|
| molecular weight | 4254 Da (PubChem) |
| computed backbone mass | 4272.72 Da |
| length | 36 residues |
| net charge (pH 7.4) | 0 |
| mean hydropathy | -1.19 |
| half-life | not characterised |
| delivery route | not characterised |
| PubChem CID | 16132350 |
| PDB | not characterised |
| UniProt parent | P01303 |
Mechanism
Y1-Y5 receptor agonist; one of the most abundant neuropeptides in the brain.
Reported targets: Y1R Y2R Y5R
Experimental structure
No experimental structure deposited in the PDB. A predicted fold is not a structure, so nothing is drawn.
Helical wheel
Residues projected at 100° per turn, the standard α-helix rotation. Shown because helicity in this peptide is described in the cited literature.
Position in the parent protein
…KRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPR…
Parent sequence from UniProt P01303. Cleaved from pro-NPY.
Reported effects
Each row is an outcome described in the literature indexed for this peptide.
| reported outcome | where it appears |
|---|---|
| appetite stimulation in models | Non-cell autonomous control of presynaptic remodeling by the hypothalamic au… Autophagy 2026 |
| anxiolytic-like activity in models | Neuropeptide Y promotes myocardial fibrosis post myocardial infarction reper… Clinical and experimental medicine 2026 |
Literature (8)
Non-cell autonomous control of presynaptic remodeling by the hypothalamic autophagy-NPY axis — Autophagy 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42609005 · DOI 10.1080/15548627.2026.2719429
Neuropeptide Y promotes myocardial fibrosis post myocardial infarction reperfusion through Neuropeptide Y receptor type 1 — Clinical and experimental medicine 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42472403 · DOI 10.1007/s10238-026-02253-w
Neuropeptide Y regulates myocardial fibrosis via NPY1R/JAK2/STAT3 signaling pathway — Biochemical pharmacology 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42612877 · DOI 10.1016/j.bcp.2026.118372
Neuropeptide Y-Graphene Oxide Complexes Inhibit Amygdala NPY-Receptor Expressing Glutamatergic Pathways and Selectively Remove Aversive Memory In Vivo — Advanced science (Weinheim, Baden-Wurttemberg, Germany) 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42535973 · DOI 10.1002/advs.76608
Impact of serotonin transporter deficiency on parvalbumin- and neuropeptide Y-producing neurons of the lateral and basolateral amygdalar nuclei — Journal of neural transmission (Vienna, Austria : 1996) 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42616085 · DOI 10.1007/s00702-026-03224-x
Effects of photoperiod on gonadal development and neuropeptide Y and NPY1 receptor in Nile tilapia (Oreochromis niloticus) — Fish physiology and biochemistry 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42455188 · DOI 10.1007/s10695-026-01742-9
Neuropeptide Y in cancer metastasis and chemoresistance — Neuropeptides 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42314268 · DOI 10.1016/j.npep.2026.102638
Pro-neuropeptide Y as a circulating biomarker for poor prognosis in prostate cancer — Scientific reports 2026
Prostate cancer (PCa) is common world-wide. Current diagnostics based on testing for circulating levels of prostate specific antigen (PSA) is unspecific, and novel prognostic markers are needed for personalized therapeutic strategies. Pro-neuropeptide Y (pro-NPY) has been reported as a tissue marker for PCa related to poor prognosis. This study explored the prognostic value of circulating pro-NPY in PCa. Plasma samples were obtained from two patient cohorts: (1) men examined due to increased PSA levels in 2003-2011 (n = 796) and (2) patients treated for PCa in 2013-2016 (n = 92). Cohort 2 also provided plasma samples collected ~ 3 months after therapy. For plasma pro-NPY assessment, a sandwich immunoassay was developed. In cohort 1, 315 patients were diagnosed with PCa at the time for blood sampling, 137 were diagnosed during follow-up, and 344 remained disease-free. Plasma pro-NPY provi…
open access ↗ · PMID 42337319 · DOI 10.1038/s41598-026-58517-8
The mechanism, illustrated
Not memed yet.
33 of the 100 indexed peptides have one. See which →
Related
Glucagon
hormone · 8 citations
Ghrelin
hormone · 8 citations
Oxytocin
hormone · 8 citations
Vasopressin
hormone · 8 citations
Gonadorelin
hormone · 8 citations
Kisspeptin-10
hormone · 8 citations