biohacking$bioLLM CA: TBA

database / hormone

Substance P

research compound hormone nervousimmune modified — mass check n/a
SOOOOOOOOOOOOONNNNNNNNNNNNNNNNNNHHHHHHHHHHHHHHHHHHHHHH
95 heavy atoms · 196 bonds · drag to pan, scroll to zoom C63N18O13S1

Skeletal structure drawn from the computed atomic coordinates in PubChem CID 36511. Carbons are implicit vertices, hydrogens on carbon suppressed. Every atom sits where PubChem placed it.

Sequence

RPKPQQFFGLM

Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met

1. Arg — Arginine · positive · hydropathy -4.5 · charge +1R12. Pro — Proline · proline · hydropathy -1.6 · charge 0P3. Lys — Lysine · positive · hydropathy -3.9 · charge +1K4. Pro — Proline · proline · hydropathy -1.6 · charge 0P5. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q6. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q67. Phe — Phenylalanine · aromatic · hydropathy 2.8 · charge 0F8. Phe — Phenylalanine · aromatic · hydropathy 2.8 · charge 0F9. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G10. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L11. Met — Methionine · hydrophobic · hydropathy 1.9 · charge 0M11

Modified molecule. C-terminal amide.

Backbone carries modifications, so computed backbone mass is not comparable to the reported mass of the complete molecule.

Molecular data

Chemical fields come from the PubChem compound record; computed values are derived from the sequence shown above.
molecular formulaC63H98N18O13S
molecular weight1347.6 Da (PubChem)
computed backbone mass1348.63 Da
length11 residues
net charge (pH 7.4)+2
mean hydropathy-0.7
half-lifenot characterised
delivery routenot characterised
PubChem CID36511
PDBnot characterised
UniProt parentP20366

Mechanism

Tachykinin NK1 receptor agonist; a principal nociceptive and inflammatory neuropeptide.

Reported targets: NK1R

Experimental structure

No experimental structure deposited in the PDB. A predicted fold is not a structure, so nothing is drawn.

Position in the parent protein

exact match at residues 58–68 of Protachykinin-1 (129 aa)

…WYDSDQIKEELPEPFEHLLQRIARRPKPQQFFGLMGKRDADSSIEKQVALLKALYGHGQ…

Parent sequence from UniProt P20366. Substance P is a protachykinin-1 cleavage product.

Reported effects

Each row is an outcome described in the literature indexed for this peptide.

Reported observations and the corpus they are drawn from.
reported outcomewhere it appears
nociceptive signallingBroadening the View: Substance P and Its Metabolism in Pruritus-Related Dise… The Journal of dermatology 2026
neurogenic inflammationWeekly electroejaculation did not negatively affect substance P and temperam… American journal of veterinary research 2026

Literature (8)

Broadening the View: Substance P and Its Metabolism in Pruritus-Related Diseases — The Journal of dermatology 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42244108 · DOI 10.1111/1346-8138.70328

Weekly electroejaculation did not negatively affect substance P and temperament scoring in young bulls — American journal of veterinary research 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42468553 · DOI 10.2460/ajvr.26.05.0235

Change in Swallowing Function and Substance P Levels Associated with Nicergoline in Neurological Disease: A Pilot Study — Journal of clinical medicine 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42355896 · DOI 10.3390/jcm15124728

Change in Swallowing Function and Substance P Levels Associated with Nicergoline in Neurological Disease: A Pilot Study — Journal of clinical medicine 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

open access ↗

Immunohistochemical analysis of substance P from  cerebral ganglion of S. maculata and B. bengalensis — Research Square 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · DOI 10.21203/rs.3.rs-9908743/v1

Correction to "Substance P and NK-1R in Dengue: A First Serological Investigation" — Health science reports 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42591736 · DOI 10.1002/hsr2.73048

Salivary Substance P Levels During Cesarean Section Under Spinal versus General Anesthesia: A Prospective Study — Journal of pain research 2026

BackgroundSubstance P is a key neuropeptide involved in the transmission of nociceptive (pain) signals. The choice of anesthesia for childbirth, particularly for cesarean section (CS), is a critical decision that directly impacts the mother's physiological response to the procedure. This study aims to compare the levels of salivary SP in pregnant women undergoing CS under spinal versus general anesthesia.MethodsEighty-three patients participated in this prospective comparative study. They were categorized into two groups: general and spinal anesthesia groups. The primary outcome was to measure the mean difference in salivary substance P level at three different time points of CS, and to compare these values between both groups. The secondary outcome was to assess the factors affecting the substance P levels in the mothers.ResultsThe study included 44 (53%) who received spinal anesthesia …

open access ↗ · PMID 42088763 · DOI 10.2147/jpr.s584688

Striatum regulates the cortex via the basal forebrain cholinergic system: A role for substance P — Trends in neurosciences 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42392894 · DOI 10.1016/j.tins.2026.06.007

The mechanism, illustrated

Not memed yet.

33 of the 100 indexed peptides have one. See which →

Related

Glucagon

hormone · 8 citations

Ghrelin

hormone · 8 citations

Oxytocin

hormone · 8 citations

Vasopressin

hormone · 8 citations

Gonadorelin

hormone · 8 citations

Kisspeptin-10

hormone · 8 citations