database / immune
KPV
also known as α-MSH (11-13), KPV tripeptide, lysine-proline-valine
Skeletal structure drawn from the computed atomic coordinates in PubChem CID 125672. Carbons are implicit vertices, hydrogens on carbon suppressed. Every atom sits where PubChem placed it.
Sequence
KPV
Lys-Pro-Val
- hydrophobic
- positive
- negative
- polar
- aromatic
- glycine
- proline
- cysteine
Computed backbone mass 342.44 Da agrees with PubChem's reported 342.43 Da (Δ 0.01 Da). Two independent sources agree on the primary structure.
Molecular data
| molecular formula | C16H30N4O4 |
|---|---|
| molecular weight | 342.43 Da (PubChem) |
| computed backbone mass | 342.44 Da |
| length | 3 residues |
| net charge (pH 7.4) | +1 |
| mean hydropathy | -0.43 |
| half-life | not characterised |
| delivery route | not characterised |
| PubChem CID | 125672 |
| PDB | not characterised |
| UniProt parent | P01189 |
Mechanism
C-terminal tripeptide of α-MSH; studied for anti-inflammatory activity independent of pigmentation effects.
Reported targets: melanocortin pathway
Experimental structure
No experimental structure deposited in the PDB. A predicted fold is not a structure, so nothing is drawn.
Position in the parent protein
…RSDGAKPGPREGKRSYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPL…
Parent sequence from UniProt P01189. KPV is the C-terminal tripeptide of α-MSH, itself a POMC product.
Reported effects
Each row is an outcome described in the literature indexed for this peptide.
| reported outcome | where it appears |
|---|---|
| anti-inflammatory activity | Lysine-proline-valine peptide attenuates hepatic lipid accumulation through … Cytotechnology 2026 |
| intestinal inflammation reduction | KPV attenuates adipogenesis and lipid metabolism through modulation of ROS-m… Tissue & cell 2026 |
Literature (8)
Lysine-proline-valine peptide attenuates hepatic lipid accumulation through ROS-dependent regulation of the PPARγ pathway in HepG2 cells — Cytotechnology 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42064835 · DOI 10.1007/s10616-026-00967-z
KPV attenuates adipogenesis and lipid metabolism through modulation of ROS-mediated AKT/mTORC1/PPARγ signaling — Tissue & cell 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42585803 · DOI 10.1016/j.tice.2026.103837
Lysine-Proline-Valine peptide mitigates fine dust-induced keratinocyte apoptosis and inflammation by regulating oxidative stress and modulating the MAPK/NF-κB pathway — Tissue & cell 2025
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 40073467 · DOI 10.1016/j.tice.2025.102837
NLRP3 autophagic degradation disruption in melanocytes contributes to vitiligo development — Cell death and differentiation 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 40935835 · DOI 10.1038/s41418-025-01578-5
KPV and RAPA Self-Assembled into Carrier-Free Nanodrugs for Vascular Calcification Therapy — Advanced healthcare materials 2024
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 39252648 · DOI 10.1002/adhm.202402320
Correlative evaluation of anticancer effects of a modified methioninase MGL-KPV using 2D and 3D cell models, human cancer xenografts in zebrafish embryos and Balb/c nude mice — bioRxiv 2025
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · DOI 10.64898/2025.12.23.696173
Inflammation-triggered self-immolative conjugates enable oral peptide delivery by overcoming gastrointestinal barriers — Science advances 2026
Oral delivery of peptide therapeutics remains challenging due to gastrointestinal (GI) degradation and poor intestinal absorption. Here, we propose a self-immolative peptide prodrug conjugate (SIPPC) platform for inflammation-targeted oral delivery, integrating a hydrophilic polyethylene glycol segment, a reactive oxygen species (ROS)-responsive hydrophobic self-immolative module, and a hydrolyzable scaffold, which collectively enable spontaneous assembly into micelle-like nanoparticles. Using three anti-inflammatory peptides (KPV, Ac-QAW, and IRW), we demonstrated that the engineered conjugates exhibit remarkable GI stability, efficient mucus penetration, and ROS-responsive release at inflamed sites. In colitis mice, the KPV-based conjugate (proKPV) achieved a 3.8-fold greater colonic accumulation than free KPV, with enhanced efficacy even at a 20-fold lower dose. Beyond therapeutic eff…
open access ↗ · PMID 41533788 · DOI 10.1126/sciadv.aea2989
A PepT1 mediated medicinal nano-system for targeted delivery of cyclosporine A to alleviate acute severe ulcerative colitis — Biomaterials science 2019
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 31408067 · DOI 10.1039/c9bm00925f
The mechanism, illustrated
Not memed yet.
33 of the 100 indexed peptides have one. See which →
Related
Semax
nootropic · 8 citations
Tuftsin
immune · 8 citations
Thymosin α1
immune · 8 citations
LL-37
immune · 8 citations
Human β-defensin 2
immune · 8 citations
Thymulin
immune · 8 citations