database / immune
Thymosin α1
also known as thymalfasin, Zadaxin
Skeletal structure drawn from the computed atomic coordinates in PubChem CID 16130571. Carbons are implicit vertices, hydrogens on carbon suppressed. Every atom sits where PubChem placed it.
Sequence
SDAAVDTSSEITTKDLKEKKEVVEEAENG
Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn-Gly
- hydrophobic
- positive
- negative
- polar
- aromatic
- glycine
- proline
- cysteine
Modified molecule. N-terminally acetylated in the native and therapeutic forms.
Backbone carries modifications, so computed backbone mass is not comparable to the reported mass of the complete molecule.
Molecular data
| molecular formula | C129H215N33O55 |
|---|---|
| molecular weight | 3108.3 Da (PubChem) |
| computed backbone mass | 3123.33 Da |
| length | 29 residues |
| net charge (pH 7.4) | -5 |
| mean hydropathy | -1.01 |
| half-life | not characterised |
| delivery route | subcutaneous |
| PubChem CID | 16130571 |
| PDB | not characterised |
| UniProt parent | P06454 |
Mechanism
Thymic peptide studied as a TLR-pathway immunomodulator; used clinically in several countries.
Reported targets: TLR2 TLR9
Experimental structure
No experimental structure deposited in the PDB. A predicted fold is not a structure, so nothing is drawn.
Position in the parent protein
MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAENEENGEQEADNEVD…
Parent sequence from UniProt P06454. Thymosin α1 corresponds to the N-terminal region of prothymosin α.
Reported effects
Each row is an outcome described in the literature indexed for this peptide.
| reported outcome | where it appears |
|---|---|
| T-cell modulation | Methodological Considerations in Interpreting IL-15 Plus Thymosin α1 Therapy… Journal of gastroenterology and hepatology 2026 |
| antiviral response in trials | Comments on IL-15 Plus Thymosin α1 Reduces Senescent Hepatic CD8+ T Cells in… Journal of gastroenterology and hepatology 2026 |
Registered trials
| NCT | title | status | phase |
|---|---|---|---|
| NCT05339529 | Protective Effect of Thymosin Α1 Against Negative Immune Dysregulation and Organ Dysfunction | RECRUITING | NA |
| NCT02366247 | Phase Ⅲ Trial for Combination Treatment of PEG-Tα1 and Adefovir for HBeAg-positive Chronic H | UNKNOWN | PHASE3 |
| NCT01943617 | Optimized Treatment and Regression of HBV-induced Compensated Liver Cirrhosis | COMPLETED | PHASE4 |
| NCT02233075 | REP 2139-Ca / Pegasys™ Combination Therapy in Hepatitis B / Hepatitis D Co-infection | COMPLETED | PHASE2 |
| NCT02473406 | Thymosin Alpha 1 in the Prevention of Pancreatic Infection Following Acute Necrotizing Pancr | COMPLETED | PHASE4 |
Literature (8)
Methodological Considerations in Interpreting IL-15 Plus Thymosin α1 Therapy for Hepatocellular Carcinoma — Journal of gastroenterology and hepatology 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42464890 · DOI 10.1111/jgh.70607
Comments on IL-15 Plus Thymosin α1 Reduces Senescent Hepatic CD8+ T Cells in Hepatocellular Carcinoma via PI3K/AKT Suppression — Journal of gastroenterology and hepatology 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42464431 · DOI 10.1111/jgh.70592
P-30. Thymosin-α1 for Sepsis Management: A Systematic Review and Meta-Analysis of 1972 Patients — Open forum infectious diseases 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
Comparative efficacy and safety of immunomodulatory therapies for sepsis: a systematic review and network meta-analysis — Frontiers in medicine 2026
BackgroundAs a standard therapy, immunotherapy is widely used for sepsis patients. Despite the presence of various immunomodulators, studies comparing their safety and efficacy synthetically are still lacking.MethodsElectronic databases (PubMed, Embase, and the Cochrane Library) were searched from inception to March 31, 2025. The primary endpoint assessed was all-cause mortality, whereas secondary outcomes included duration of mechanical ventilation (MV duration), length of intensive care unit (ICU-LOS) and hospital stay (hospital-LOS). Safety was evaluated by monitoring adverse events or serious adverse events (AEs/SAEs). For effect estimation, the risk ratio (RR) and mean difference (MD) with a 95% confidence interval (95% CI) were utilized. The network meta-analysis was executed via the 'BUGSnet' and 'JAGS' packages within R 4.4.2. Interventions were ranked by surface under the cumula…
open access ↗ · PMID 42205841 · DOI 10.3389/fmed.2026.1808427
Expression levels of thymosin α1 in acute myocardial infarction patients and its correlation to cardiac function — Frontiers in cardiovascular medicine 2025
BackgroundEarly prediction of heart failure (HF) after acute myocardial infarction (AMI) remains a clinical challenge. There is a lack of studies investigating Thymosin α1 expression levels in AMI patients and its relationship with cardiac function post-AMI.MethodsThis retrospective analysis included patients with AMI from December 2019 to February 2022. The baseline data of two groups were collected. Thymosin α1 expression level of peripheral blood plasma in AMI patients was examined by ELISA. Logistic regression analysis was applied to evaluate risk factors in-hospital cardiac dysfunction after emergency PCI in AMI patients. Receiver operating characteristic (ROC) curve was used to analyze the predictive value of the biomarker.ResultsA total of 307 hospitalized patients were enrolled in this study, divided into AMI group (n = 274) and non-AMI group (n = 33). The expression level of thy…
open access ↗ · PMID 41019435 · DOI 10.3389/fcvm.2025.1635557
Thymosin α1 combined with immune checkpoint inhibitors: synergistic remodeling of the tumor immune microenvironment to enhance clinical efficacy and safety — Frontiers in immunology 2026
Although immune checkpoint inhibitors (ICIs) have revolutionized the therapeutic landscape of solid tumors, their clinical utility remains constrained by several challenges, including tumor heterogeneity, immunosuppressive tumor microenvironments, and immune-related adverse events (irAEs), which collectively limit overall response rates. Thymosin α1 (Tα1), a pleiotropic immunomodulator, not only enhances immune competence and regulates excessive immune activation but also exerts direct antitumor effects. Given these immunoregulatory and antitumor properties, a growing body of preclinical and clinical studies has investigated the combination of Tα1 with ICIs, demonstrating its potential to augment the efficacy of ICIs and mitigate their limitations. In this review, we summarize and discuss the biological characteristics of Tα1 and current evidence regarding the synergistic effects of Tα1 …
open access ↗ · PMID 42292432 · DOI 10.3389/fimmu.2026.1762151
MRAP mediated adipocyte differentiation by thymic mesenchymal stromal cells contributes to thymic involution — Nature communications 2025
Adipocyte deposition is believed to be a primary characteristic of age-related thymic involution, but the underlying cellular and molecular mechanisms remain unknown. We show here that thymic mesenchymal stromal cells (tMSCs) have a higher tendency to differentiate into adipocytes and melanocortin-2 receptor accessory protein (MRAP) is a potential driver of tMSCs adipogenesis. Furthermore, we discover that thymosin-α1 promotes MRAP expression in tMSCs through FoxO1 signaling pathway. Additionally, the proportion of tMSCs increase in older mice compared to young mice. Importantly, MRAP is also necessary for human thymic MSCs to differentiate into adipocytes when exposed to thymosin-α1. Single-cell RNA-seq analysis of human thymus revealed an accumulation of tMSCs and adipocytes during aging, indicating a strong potential for adipogenic differentiation in age-related thymic involution. Thu…
open access ↗ · PMID 41266306 · DOI 10.1038/s41467-025-64973-z
Thymosin α1 alleviates pulpitis by inhibiting ferroptosis of dental pulp cells — International journal of oral science 2025
Tooth pulpitis is a prevalent oral disorder. Understanding the underlying mechanisms of pulpitis and developing effective treatment strategies hold great significance. Ferroptosis has recently emerged as a new form of cell death, but the role of ferroptosis in pulpitis remains largely unknown. In our study, single-cell RNA sequencing (scRNA-seq) was used to identify cellular heterogeneity between 3 pulpitis tissue and 3 healthy pulp tissue, and explored ferroptosis occurrence in pulpitis tissue and inflamed dental pulp cells (DPCs). In scRNA-seq, 40 231 cells (Pulpitis: 17 814; Healthy pulp: 22 417) were captured, and visualized into 12 distinct cell clusters. Differentially expressed ferroptosis-related genes (DE-FRGs) were almost presented in each cluster in pulpitis vs healthy pulp. ROS and Fe2+ levels significantly rose, and immunohistochemistry showed low expression of GPX4 and high…
open access ↗ · PMID 41087337 · DOI 10.1038/s41368-025-00394-4
The mechanism, illustrated