database / immune
LL-37
also known as cathelicidin antimicrobial peptide
Sequence
[LL-37, 37 aa]
Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
- hydrophobic
- positive
- negative
- polar
- aromatic
- glycine
- proline
- cysteine
No independent molecular weight was available to check the sequence against.
Molecular data
| molecular formula | not characterised |
|---|---|
| molecular weight | 4493.32 Da (computed from sequence) |
| computed backbone mass | 4493.32 Da |
| length | 37 residues |
| net charge (pH 7.4) | +6 |
| mean hydropathy | -0.72 |
| half-life | not characterised |
| delivery route | not characterised |
| PubChem CID | not characterised |
| PDB | 2K6O |
| UniProt parent | P49913 |
Mechanism
Human cathelicidin-derived antimicrobial peptide; forms an amphipathic helix that disrupts microbial membranes.
Reported targets: microbial membranes FPR2
Experimental structure
α-carbon backbone trace rendered from the deposited coordinates of PDB 2K6O. This is measured structure, not a prediction.
Helical wheel
Residues projected at 100° per turn, the standard α-helix rotation. Shown because helicity in this peptide is described in the cited literature.
Position in the parent protein
…GTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESParent sequence from UniProt P49913. LL-37 is the mature C-terminal peptide of hCAP18.
Reported effects
Each row is an outcome described in the literature indexed for this peptide.
| reported outcome | where it appears |
|---|---|
| antimicrobial activity | Impact of cathelicidin cleavage by SpeB on <i>Streptococcus pyogenes</i> C… bioRxiv 2026 |
| wound healing in models | Combinatorial therapy of LL-37 and ADSCs accelerates diabetic wound repair b… Cytokine 2026 |
| immune modulation | Antibiotic loaded solid lipid nanoparticles target bacteria in a pyogenic sp… Discover nano 2026 |
Registered trials
| NCT | title | status | phase |
|---|---|---|---|
| NCT07496710 | Relationship Between Nutritional Status, Physical Activity and Periodontal Status | COMPLETED | — |
| NCT05054361 | Crosstalk Between Mucosal-Associated Invariant T (MAIT) Cells and the Gut Microbiota and Muc | RECRUITING | — |
| NCT02058407 | A Study to Evaluate the Safety, Tolerability, Pharmacokinetics (PK), Pharmacodynamics (PD) a | TERMINATED | PHASE1 |
| NCT05969275 | Umbilical Mesenchymal Stromal Cells as Cellular Immunotherapy for Septic Shock | RECRUITING | PHASE2 |
| NCT06867250 | Peri-implant Vitamin D and Cathelicidin (LL-37) Levels | COMPLETED | — |
Literature (8)
Impact of cathelicidin cleavage by SpeB on <i>Streptococcus pyogenes</i> CovRS signaling — bioRxiv 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · DOI 10.64898/2026.08.12.744433
Combinatorial therapy of LL-37 and ADSCs accelerates diabetic wound repair by orchestrating NRROS-mediated crosstalk between TGF-β/SMAD and hippo/TEAD1 axes — Cytokine 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42641316 · DOI 10.1016/j.cyto.2026.157203
Antibiotic loaded solid lipid nanoparticles target bacteria in a pyogenic spondylitis rat model — Discover nano 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42560613 · DOI 10.1186/s11671-026-04853-7
Melanoma exosomal hsa-miR-221-5p suppresses keratinocyte LL-37 to promote tumor progression — Cell reports 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42593966 · DOI 10.1016/j.celrep.2026.117837
Targeted delivery of antimicrobial peptide LL-37 via ferritin fusion improves antibacterial and anti-inflammatory outcomes in a murine sepsis model — International journal of biological macromolecules 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42669340 · DOI 10.1016/j.ijbiomac.2026.154251
LL-37 IgG levels are associated with clinical characteristics and T follicular cell response in acute coronary syndrome in adults — Physiological reports 2026
Elevated LL-37 IgG levels are implicated in inflammatory conditions and immune complexes formed with LL-37 potentially propagate immunothrombosis in acute coronary syndrome (ACS). The reported binding of LL-37 to LDL may be relevant in this context given that LDL autoantibodies are implicated in ACS risk. In this report, three distinct cohorts were used to evaluate immunologic characteristics, clinical relevance, and potential mechanisms of elevated LL-37 IgG levels in ACS. First, evaluation of IgG reactive to native (n) LDL and LL-37 complexed with LDL (LL-37_LDL) in a cohort without acute disease demonstrated significantly higher levels of LL-37 IgG compared to LL-37_LDL IgG and nLDL IgG. Next, evaluation of LL-37 IgG levels in samples (N = 500) from the AZACS study (Azithromycin in ACS) and population-level associations with clinical characteristics showed that LL-37 IgG levels were s…
open access ↗ · PMID 42304820 · DOI 10.14814/phy2.70914
LL-37 inhibits osteosarcoma progression by suppressing SQLE-mediated cholesterol synthesis via the PTEN/AKT/mTOR pathway — Journal of bone oncology 2026
Osteosarcoma (OS) is an aggressive primary bone malignancy with poor prognosis for metastatic and recurrent cases, highlighting an urgent need for novel therapeutic strategies. The human cathelicidin peptide LL-37 exerts context-dependent anti-tumor effects, yet its functional role in OS remains largely undefined. This study aimed to explore the anti-OS activity and underlying mechanisms of LL-37.MethodsIn vitro experiments were performed using OS cell lines and normal human bone marrow mesenchymal stem cells (hBMSCs) to assess cell viability, clonogenic survival, migration, invasion, cell cycle distribution, cell death, and cholesterol metabolism. Transcriptomic profiling, siRNA-mediated knockdown, plasmid overexpression, and rescue experiments were conducted to validate key signaling pathways. The in vivo therapeutic efficacy of LL-37 was evaluated using a 143B cell xenograft model.Res…
open access ↗ · PMID 42388271 · DOI 10.1016/j.jbo.2026.100779
<em>In Vivo</em> Efficacy of LL-37 and Its Derivative Peptides Against Methicillin-Resistant <em>Staphylococcus aureus</em> in Animal Models: A Systematic Review and Meta-Analysis — Preprints.org 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · DOI 10.20944/preprints202608.1009.v1
The mechanism, illustrated
Related
KPV
immune · 8 citations
Tuftsin
immune · 8 citations
Thymosin α1
immune · 8 citations
Human β-defensin 2
immune · 8 citations
Thymulin
immune · 8 citations
Melittin
immune · 8 citations